Redwolf - Bongo Cat - Sticker
Description
The artwork will be digitally printed on a Redwolf vinyl sticker with a matte finish. The sticker is easy to remove and residue-free.
Technical Details
| Weight: | 5.00g |
Price history chart & currency exchange rate
Customers also viewed

$16.21
ZIBLON Ethnic Motifs Yoke Design Round Neck Straight Kurta With Trousers & Dupatta, Purple
myntra.com$2.16
polymailer hd ekonomis ukuran 30 × 40 plastik packing tebal warna white putih isi 100 lembar packing online tebal murah packinganbajuonlinepackingonlineputihdoffmattewhitepolymailerwhitemattepackinganpalstikpolymailerputihmatteputihdoff
shopee.co.id
$15.27
eye frame selling rhinestone jewelry fashion street snap multilayer glasses frame european and american fashion facial accessories frame des, Silver
dhgate.com
$23.36
brand sweatshirt men hoodies winter solid hoodie mens hip hop coat pullover men's casual brand man clothes tracksuits masculino 201126, Black
dhgate.com
$16.96
sandals women pu leather shoes comfy platform flat sole ladies casual soft big toe foot correction sandal orthopedic bunion corrector 230713, Black
dhgate.com
$62.62
shoulder bags luxurys designers fashion womens t quality high crossbody handbags ladies totes sewing bucket bag purse cross body
dhgate.com
$2.72
new colorful sparkly durags turban bandanas men's shiny silky durag headwear headbands hair cover accessories wave caps rags hat dhl fr, Blue;gray
dhgate.com
$90.11
lady spain cool girl bag flamenco designer bags loewsbag cloud tote leather totes pleated designer's dark style minimalist lazy commuti
dhgate.com
$27.35
luxurys jewelry fashion women designers leather bracelets with gold heart flower stainless steel bracelet couple gifts no box5915173, Golden;silver
dhgate.com
$9.20
6.0 Professional Barber Scissors 440C Hairdressing Scissors Hair Thinning Shears Salon Hair Cutting Scissors Set
aliexpress.com
$18.96
water bottles & cages ztto 1pcs bicycle bottle holder plastic racks cup road mtb mountain bike accessories
dhgate.com
$6.29
Cute PVC Stress Pain Relief Therapy Hot Water Bottle Bag With Knitted Soft Cozy Cover Winter Warm Heat Reusable Hand Warmer
aliexpress.com
$6.50
Feeding Underwear Sets Pregnancy Clothes for Nursing Women's Bra Women Breastfeeding Bras Pregnancy Breast Underwear
aliexpress.com
$2.80
New Multifunction Stainless Steel Lemon Zester Fruit Peeler Cheese Zester Microplane Grater Fruit Vegetable Tools & Kitchen
aliexpress.com
$29.00
12 month quality guarantee fuel injector nozzle for Chevrolet Aveo Pontiac Wave 1.6 OE No. 96487553
aliexpress.com
$8.51
Elegant plus size velvet women skirt high waist office wear skirts streetwear solid color skirt green/blue casual women clothing
aliexpress.com
$2.41
Cool Cycling Caps Solid Color Breathable Quick Drying Adjustable Sweat Absorption Headscarf Outdoor Bike Bicycle Helmet
aliexpress.com
$22.95
Man Running Shoes Men Nice Zapatillas Athletic Trainers Black Sports Shoe Air Cushion Outdoor Jogging Walking Sneakers A21
aliexpress.com
$1.65
Best Capo for Acoustic Classical Electric Guitar Change Tuning Clamp Key Plastic Guitar Capo Musical Instruments Accessories
aliexpress.com$1.08
Cute Cartoon Door Stopper Leaf Style Silicon Doorstop Safety For Baby Home Decoration 4 Colors Card Hanging Door stops for doors
aliexpress.com
$13.32
Summer Denim Shorts Female New Loose Hole Shorts Summer Rose Embroidery Jeans Shorts Female Casual
aliexpress.com
$35.00
Mindray BS120&130&180&190 ,200,300,New BS200,300 Biochemistry Analyzer BA313056750 801-BA31-00035-00 Filter Assembly, 2 pcs
aliexpress.com![[old craft ] 12" Tibetan old Bronze chan sect Sakyamuni Buddha Budda Amitabha Statue (A0314)
[old craft ] 12" Tibetan old Bronze chan sect Sakyamuni Buddha Budda Amitabha Statue (A0314)](http://ae01.alicdn.com/kf/HTB1xQxgNXXXXXbnXFXXq6xXFXXXq/old-craft-12-Tibetan-old-Bronze-chan-sect-Sakyamuni-Buddha-Budda-Amitabha-Statue-A0314.jpg)
$145.08
[old craft ] 12" Tibetan old Bronze chan sect Sakyamuni Buddha Budda Amitabha Statue (A0314)
aliexpress.com
$0.81
2018 Fashion Brand Quartz Watches Bicycle Pattern Cartoon Watch Women Casual Vintage Leather Girls Kids Wristwatches gifts Clock
aliexpress.com



